DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and mlt-7

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_494777.1 Gene:mlt-7 WormBaseID:WBGene00022743 Length:724 Species:Caenorhabditis elegans

Alignment Length:583 Identity:192/584 (33%)
Similarity:299/584 (51%) Gaps:53/584 (9%)


  Fly   198 PKIVLPDPTVLRLECD----FNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRV 258
            |...:|..:.:.::|.    ::..||...|.|||.:.| ..||:...:.|.....|.||...|..
 Worm   167 PTGCVPQLSDVGVDCRKSLCYHLMYRTLDGTCNNLEKP-MQGAAFRRFNRHFPAQYDDGKGEPIS 230

  Fly   259 SHHGRLPPARQVSLKIHRSSYET--DSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAAT 321
            |.:...|.||:.: ::..||.::  ...|..|:..:||||.||::.|:|..|...::.|...:  
 Worm   231 SLNQSRPSAREAN-RVMLSSAQSVVHDKFNNMMMQWGQFMSHDMSKTTLQPSANCKTCDPVPS-- 292

  Fly   322 REQHPECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQR 386
                 :|.|:.|...||.....:..|:...||  ||..|..||.|||:.||:||.|::||:..:.
 Worm   293 -----KCMPIPIGEKDPNLGFKSKQCLKVSRS--APICRVEPREQLNENTAYIDGSMIYGSSLKD 350

  Fly   387 QNQLRSFINGSLRMFVTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHL 451
            .::.|....|.||: ...:.:.:||...:..  .|:.:.|.    .|.:||.|||..:.|:|:|:
 Worm   351 LHKFRDGRTGFLRV-TRFNNQNVLPFDQSKC--ANKDKCTA----SFTAGDIRANLFIGLSSLHI 408

  Fly   452 LWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKH 516
            ::||.||.:|::|.|.||.|..:|::||||||:|||:.::.|.|:||.|||.:..:..|  |.| 
 Worm   409 MFAREHNRIAQKLTELNPTWSGDRVFQEARKIVGAQIQNVLYKEYLPKLLGVSFDKVIG--PYK- 470

  Fly   517 NLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLF---NISRDNSTPEAIELHKMLFNPFSLWA 578
                  .||..||.:|||.|..:||||.|.::...:   ::|.:|.|.........:|....:..
 Worm   471 ------GYDTNVDATIANEFTTSAFRFGHGMIEEFYKRVDLSGNNITHGGFFFGDGVFKSGKILF 529

  Fly   579 EHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPV 643
            |.|:|..:.....|.|.:..| .:..:|:|:|..|          ||.|||||||||||||||..
 Worm   530 EGGVDPIIRGFMTTAVKRPHR-MTPAITEKMFGST----------DLGSLNIQRGRDHGIPSYNK 583

  Fly   644 FRRHCRLPTVDTWEEMSQAI-DNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVS 707
            .|:.|.|.:.:|:::.:..| |......:.:.|.:..|||.|.|::.|.|:.|.:.|..|||.:.
 Worm   584 MRQFCGLKSANTFDDFADMILDRNLRAGLARNYNTTNDVDFYVGSMLEDPVIGGLVGTTLSCAIG 648

  Fly   708 DQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGN 770
            :||.|.:.||..::|   .|..||::|:.||.|:||:.|||.|:|....|.:...  |..|.|
 Worm   649 EQFKRARDGDRFYFE---NPGIFTRSQMEEIKKSSLSRIICDNADNFELVSQDAF--LLPGSN 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 185/543 (34%)
peroxinectin_like 364..750 CDD:188655 139/390 (36%)
mlt-7NP_494777.1 ShK 41..76 CDD:279838
An_peroxidase 191..691 CDD:281139 185/541 (34%)
peroxinectin_like 328..688 CDD:188655 139/390 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5081
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.