DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and skpo-2

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_494540.1 Gene:skpo-2 WormBaseID:WBGene00015841 Length:729 Species:Caenorhabditis elegans

Alignment Length:602 Identity:189/603 (31%)
Similarity:292/603 (48%) Gaps:77/603 (13%)


  Fly   205 PTVLRLECD----FNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGRLP 265
            ||.....|:    ::.|||...|.|||.:.| ..|::.....|:.:|.|.:|:.||..|.....|
 Worm   187 PTQETPNCNRNLCYHLRYRSFDGTCNNLKKP-MIGSAFTALMRLKNPMYDNGLNAPTSSFLRSRP 250

  Fly   266 PARQVSLKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYP 330
            .||..|..:..||.:...:...:|..:|||:.||::.|::..:||      |.|.|..: ..|..
 Worm   251 SARDASRLLLSSSTQIQHHSNALLMQWGQFIAHDLSKTTMLNNQE------CAACTSNK-GRCTS 308

  Fly   331 VDILPDDPYYKQYNISCMNFVRSAP-APTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLR--S 392
            |.:...||.:.::  .|:...||.| ..||....|.|.|:.|||||.|::||:.::.|...|  :
 Worm   309 VFLSRSDPTFGRF--MCLPVARSTPVCGTGVSNFREQFNENTAFIDGSMIYGSSDRDQFLFRQGA 371

  Fly   393 FINGSL---RMFVTDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWA 454
            |:...|   |:|             .|.|..|.|          .:||||||..:.|.|:|:|:.
 Worm   372 FLKTKLINNRVF-------------PPVDKNNNV----------VAGDDRANIFVGLASLHVLYL 413

  Fly   455 RHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLN 519
            |.||.:|..||..||||:.||::.|:|||:||.:..||:.|:||.:||....|..|..|.     
 Worm   414 RQHNRIAATLQRVNPHWDQERVFHESRKIVGAMIQRITFTEYLPKVLGVAFEERIGAYPG----- 473

  Fly   520 APDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNSTPEAIELHKMLFNPFSLWAEH---- 580
                |||.:|||:||.|.:.||||.|.::...:....:...    .:..:.||.....:.|    
 Worm   474 ----YDPNIDPSVANEFTSCAFRFGHGMIQEFYPFLNEKFQ----HVGGIPFNDGMFKSTHILNN 530

  Fly   581 GIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFR 645
            |||..:......|.....| .:..||:::|..:          ||.|:|||||||||:|.|.|:|
 Worm   531 GIDPLIRGLMTLPAKMPQR-LTPAVTERIFGNS----------DLGSINIQRGRDHGVPPYTVWR 584

  Fly   646 RHCRLPTVDTWEEMSQAIDN-ATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQ 709
            :.|.||.|..:|.:.|.|.| ..:|:::.:|:....:|:|.|:|.|.|:..|:.||.|||::.:|
 Worm   585 KFCGLPEVKDFEGLKQVISNQVVIDNLKVVYKHVDAIDMYVGSLLEDPVKDALVGPTLSCIIGEQ 649

  Fly   710 FLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNPHVD 774
            |.|.:.||..|||..   :.|:..||.:|.|.:::.::|...:....|........:...:..|.
 Worm   650 FKRTRNGDRLWYENS---KVFSPEQLLQIKKITMSRVLCDAGEHFPMVPRKAFSVFKPTAHNLVK 711

  Fly   775 CQDLEGFHFNFEPWSEK 791
            |.::....:|  .|.|:
 Worm   712 CDEIPDLDYN--AWKEE 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 179/548 (33%)
peroxinectin_like 364..750 CDD:188655 136/396 (34%)
skpo-2NP_494540.1 ShKT 61..95 CDD:214586
ShKT 101..135 CDD:214586
An_peroxidase 204..690 CDD:281139 179/546 (33%)
peroxinectin_like 341..687 CDD:188655 136/396 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I1745
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 1 1.000 FOG0000133
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.