DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and Epx

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_031972.2 Gene:Epx MGIID:107569 Length:716 Species:Mus musculus

Alignment Length:697 Identity:235/698 (34%)
Similarity:337/698 (48%) Gaps:111/698 (16%)


  Fly   129 ALGDREILEEGLQPNEVNTPSFRHYRS--LSTNPEARKLARRGYVENQATIDIAKRFNYTKQPGR 191
            |||   :|||.|||.     ..|.:.:  :.|.|:.|.|::   ....|..|.|:|         
Mouse    97 ALG---LLEERLQPR-----GSRPFNATDVLTEPQLRLLSQ---ASGCALQDQAER--------- 141

  Fly   192 SNIGWGPKIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAP 256
                                |  :.:||..||.||||:|| ..|||.....|.:..:|.|..:.|
Mouse   142 --------------------C--SNKYRTITGRCNNKKHP-WLGASNQALARWLPAEYEDHRSLP 183

  Fly   257 RVSHHGR------LPPARQVSLKIHR---SSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGE 312
            .....|:      ||..|.||.:|.|   ....:|....:|...:|||:|||:..:..:.::...
Mouse   184 FGWTPGKRRNGFLLPLVRDVSNQIVRFPSKKLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAF 248

  Fly   313 S--IDCCVAATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPA-PTGRFGPRMQLNQATAFI 374
            |  :||  ..|..|.|.|:|:.|..:||..|... .|:.|.||||| |..|...|.|:|..|:|:
Mouse   249 SMGVDC--EKTCAQLPPCFPIKIPRNDPRIKNQR-DCIPFFRSAPACPQNRNKVRNQINALTSFV 310

  Fly   375 DASVVYGNLEQRQNQLRSFINGSLRMFVT-----DDGRQLLPISSNPADGC---NRVQMTRLGKY 431
            |||:|||:......:||:..| .|.:..|     |:||.|||..:...|.|   ||  ..|:.  
Mouse   311 DASMVYGSEVTLALRLRNRTN-FLGLLATNQRFQDNGRALLPFDNLHEDPCLLTNR--SARIP-- 370

  Fly   432 CFESGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEF 496
            ||.:||.|::|...||::|.|:.|.||.||.:|:..||||..::||.|||||:||.:..|||.:|
Mouse   371 CFLAGDTRSSETPKLTALHTLFVREHNRLAAELRRLNPHWSGDKLYNEARKIVGAMVQIITYRDF 435

  Fly   497 LPVLLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLL-PGLFNIS---RD 557
            ||::||:        ...:..|.....|...|||.:||.| ..||||.||:| |.:|.:.   |.
Mouse   436 LPLVLGR--------ARIRRTLGPYRGYCSNVDPRVANVF-TLAFRFGHTMLQPFMFRLDSQYRA 491

  Fly   558 NSTPEAIELHKMLFNPFSLWAEHGIDHALMTAANTPV-------MQVDRFFSLEVTQKLFEGTAE 615
            ::....:.|..:.|..:.:..|.|||..|.....||.       |.||     |:..|||:    
Mouse   492 SAPNSHVPLSSVFFASWRIIHEGGIDPILRGLMATPAKLNRQDSMLVD-----ELRDKLFQ---- 547

  Fly   616 DRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQ 679
             :|...||||.:||:||.||||:|.|..:||.|.|.......::|:.:.|..| ....::|::|.
Mouse   548 -QVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLRLYKTPD 611

  Fly   680 DVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLA 744
            ::|::.||::||.|.||..||||:|:..:||.|.:.||..|:: |.|  .|||.|...:.:.||:
Mouse   612 NIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQ-KWG--VFTKRQRKALRRISLS 673

  Fly   745 AIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEK 791
            .|:|.|: |||.|...:. |........|.|..:.  ..|...|..|
Mouse   674 RIVCDNT-GITTVSRDIF-RANIYPQGFVSCSRIP--KLNLSAWRGK 716

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 208/569 (37%)
peroxinectin_like 364..750 CDD:188655 151/406 (37%)
EpxNP_031972.2 An_peroxidase 146..684 CDD:281139 209/570 (37%)
myeloperoxidase_like 288..700 CDD:188656 163/441 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I2565
Isobase 1 0.950 0 Normalized mean entropy S5081
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.