DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and PXDNL

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_653252.4 Gene:PXDNL HGNCID:26359 Length:1463 Species:Homo sapiens

Alignment Length:932 Identity:270/933 (29%)
Similarity:406/933 (44%) Gaps:188/933 (20%)


  Fly    23 PYQGPERVFPGGV--SPRARRNKMRQFQC----CMGITFIAIVFTALCLALVFSDSLGGADGGPS 81
            |.:|...|...|.  ..||.::...|::|    .:|:..:::..|....||.....|      |.
Human   460 PVEGQHTVLSSGTLRIDRAAQHDQGQYECQAVSSLGVKKVSVQLTVKPKALAVFTQL------PQ 518

  Fly    82 FFFVVNGSDSELAPNRPLPDEPAAEWALQQAALGHHDGAQAVSAG-------------------- 126
            ...|..|.:..::.:.....:|...|        :.:|.|...:|                    
Human   519 DTSVEVGKNINISCHAQGEPQPIITW--------NKEGVQITESGKFHVDDEGTLTIYDAGFPDQ 575

  Fly   127 ---------------------IKALGDRE---------ILEEGLQPNEVNTPSFRHYRSLSTNPE 161
                                 :.|:..|:         ||:...:.:.....:.||..|...:..
Human   576 GRYECVARNSFGLAVTNMFLTVTAIQGRQAGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTS 640

  Fly   162 ARKLARRGYVENQATIDIAKR---FNYTKQPGRSNIGWGPKIVLP----------DPTVLRL--- 210
            :..||:..|..:...:::|:.   |.:|.|..|..:..|..:.|.          .|..|.|   
Human   641 SDLLAQFHYPRDPLIVEMARAGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDLVSPRSLSLIAN 705

  Fly   211 -----------ECD---FNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPR---- 257
                       .|.   |:|:||...|.|||.|.| |:||::..:.|::.|.|.|||.|||    
Human   706 LSGCTARRPLPNCSNRCFHAKYRAHDGTCNNLQQP-TWGAALTAFARLLQPAYRDGIRAPRGLGL 769

  Fly   258 -VSHHGRLPPARQVSLKIHRSSYET-DSNFTVMLAVFGQFMDHDI--TATSLTTSQEGESIDCCV 318
             |.....|||.|.|:....|::..| |.::|.||..:|.|::||:  |..:|:|::..:...|..
Human   770 PVGSRQPLPPPRLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSS 834

  Fly   319 AATREQHPECYPVDILPDDPYYKQYNISCMNFVRSAPA-PTGRFGP---------RMQLNQATAF 373
            ..|.:  |.|:|::....||  :..:..||.|.||:|| .:||  |         |.|:||.||:
Human   835 VCTND--PPCFPMNTRHADP--RGTHAPCMLFARSSPACASGR--PSATVDSVYAREQINQQTAY 893

  Fly   374 IDASVVYGNLEQRQNQLR--SFINGSLRMFV--TDDGRQLLPISSNPADGCNRVQMTRLGKYCFE 434
            ||.|.|||:.|:....||  |...|.|:...  ...|:.|||.|:.|...|.|.:..   ..||.
Human   894 IDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQE---SPCFL 955

  Fly   435 SGDDRANENLLLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPV 499
            :||.||||:|.|.:||.||.|.||.:|.:|...|||||...:|||||||:||::.||||:.:||.
Human   956 AGDHRANEHLALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPK 1020

  Fly   500 LLGKNISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLL-PGLFNISRDNSTPEA 563
            :||.         |....|.....|:|.|:..|.|.||.|||||.|||: |.|:.:   |:|...
Human  1021 VLGD---------PGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRL---NATLGE 1073

  Fly   564 IE-----LHKMLFNPFSLWAEHGIDHALMTAANTPVMQ-----------VDRFFSLEVTQKLFEG 612
            |.     .||.||:|..:..|.|||         ||::           .....|.|:||:||..
Human  1074 ISEGHLPFHKALFSPSRIIKEGGID---------PVLRGLFGVAAKWRAPSYLLSPELTQRLFSA 1129

  Fly   613 TAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAI-DNATLDSIRQIYE 676
            ...     ..:|..:..||||||||||.|..||..|.|.:|..:|::...| |:.....:|::|.
Human  1130 AYS-----AAVDSAATIIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYG 1189

  Fly   677 SPQDVDVYTGALSEPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKT 741
            ||.|:|::...:.|..:.|...||.|.|:...||.||:.||..|||   .|..||.|||.::.:.
Human  1190 SPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYE---NPGVFTPAQLTQLKQA 1251

  Fly   742 SLAAIICRNSDGITRVREHVMQRLRDGGNPHVDCQDLEGFHFNFEPWSEKQQPQDLHSAGISRGS 806
            ||:.::|.|.|.|.:|:..|..: .:....:::|.::.  ..:...|      ||..:...|||.
Human  1252 SLSRVLCDNGDSIQQVQADVFVK-AEYPQDYLNCSEIP--KVDLRVW------QDCCADCRSRGQ 1307

  Fly   807 TSVRVMSKANHQAHNVTLHIDK 828
            ...........::...:..:||
Human  1308 FRAVTQESQKKRSAQYSYPVDK 1329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 215/577 (37%)
peroxinectin_like 364..750 CDD:188655 156/408 (38%)
PXDNLNP_653252.4 LRR 1 51..72
leucine-rich repeat 52..85 CDD:275378
LRR_8 53..134 CDD:316378
LRR 2 75..96
leucine-rich repeat 86..123 CDD:275378
LRR 3 99..120
LRR_8 123..182 CDD:316378
LRR 4 123..144
leucine-rich repeat 124..147 CDD:275378
LRR 5 147..168
leucine-rich repeat 148..171 CDD:275378
leucine-rich repeat 172..184 CDD:275378
LRRCT 180..232 CDD:214507
Ig_3 234..309 CDD:316449
Ig_3 329..402 CDD:316449
Ig 432..505 CDD:325142 10/45 (22%)
Ig 528..596 CDD:325142 5/76 (7%)
peroxidasin_like 851..1286 CDD:188658 174/472 (37%)
VWC 1400..1450 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.