DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and epx

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_002933592.2 Gene:epx XenbaseID:XB-GENE-6039946 Length:716 Species:Xenopus tropicalis

Alignment Length:743 Identity:225/744 (30%)
Similarity:353/744 (47%) Gaps:109/744 (15%)


  Fly   108 ALQQAALGHHDGAQAVSAGI--------KALGD------REILEEGLQPNEVNTPSFRHYRSLST 158
            ::|..|..::||.:.:...:        |.|.|      |.:|:|.|:...|:......|.....
 Frog    16 SVQITASSYYDGVEELDNNLILSCTKEAKHLVDIAYKNTRLMLKERLRKRTVSASDLMAYFKQPV 80

  Fly   159 NPEARKLARRGYVENQATIDIAKR--------FNYTKQPGRSNIGWGPKIVLPDPTVLRLE-CDF 214
            ......:....|:.....: ::|:        ||.|.....:.|          .|:.:|. |.:
 Frog    81 AGSRNAIRAADYMGTTLQL-LSKKLQPFHHRPFNITDLLTETQI----------DTIYKLTGCAY 134

  Fly   215 --------NARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPR-----VSHHG-RLP 265
                    .:.||..||.|||:::| ..|||...:.|::...|.||::.||     :..:| .||
 Frog   135 QHLPRACQESTYRTITGECNNRKNP-ILGASNTGFTRLLPAVYEDGVSLPRGWTENLPINGFPLP 198

  Fly   266 PARQVSLKIHRSSYET---DSNFTVMLAVFGQFMDHDITATSLTTSQEG--ESIDCCVAATREQH 325
            .||.||.:|.|...|.   |....::...:||:.|||:..:..|.::..  |.|||..:..::  
 Frog   199 LARAVSNEIVRFPNENLTLDQGRALIFMQWGQWTDHDLDLSPETPARSTFLEGIDCDTSCAKQ-- 261

  Fly   326 PECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGN-------L 383
            |.|:|:.|.|:||..:..: .|:...||:|..|.....|.|:|..|:|:|.|.|||:       |
 Frog   262 PPCFPLKIPPNDPRIRNQS-DCIPLFRSSPVCTPGSPVREQINVLTSFLDGSQVYGSDWPLAVKL 325

  Fly   384 EQRQNQLRSFINGSLRMFVTDDGRQLLPISSNPADGC---NRVQMTRLGKYCFESGDDRANENLL 445
            ....|||...   ::....||:|...||..:...|.|   ||..    |..||..||.|.:|...
 Frog   326 RNNTNQLGLM---AINQKFTDNGLPFLPFETAEEDFCVLTNRSS----GIPCFLGGDPRVSEQPG 383

  Fly   446 LTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKG 510
            ||:.|.|:.|.||.:|.:|:|.||.|..|.||||||||:|..:..|||.::||:|||   ||...
 Frog   384 LTAFHTLFVRAHNNIATRLRELNPRWSGETLYQEARKIVGGILQKITYKDWLPLLLG---SEMAT 445

  Fly   511 LLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLL-PGLFNIS---RDNSTPEAIELHKMLF 571
            :|||..      :|:..|||.:||.| ...||..|||: |.::.::   |..:....:.||...|
 Frog   446 VLPAYR------SYNENVDPRVANVF-TVVFRMGHTLIQPFIYRLADGYRPLNPEPRVPLHMTFF 503

  Fly   572 NPFSLWAEHGIDHAL--MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGR 634
            |.:.:..|.|||..|  :.|....:.:.::....|:.::||  ....|:   ||||.::|:||||
 Frog   504 NSWRVVREGGIDPLLRGLMANRAKLNRQNQLVVDELRERLF--VLFKRI---GLDLTAINMQRGR 563

  Fly   635 DHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIF 698
            :||:|.|..:||.|.|......:|::..::|..| :...::|.:|:::|::.|.::|..:.....
 Frog   564 EHGLPGYNAWRRFCGLSAPRNVDELAAVLNNRGLAEKFVKLYGTPENIDIWVGGVAESLVRNGRI 628

  Fly   699 GPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVM- 762
            |.||:|::.:||.|.:.||..:||:   |..||.||.|.|.:.:||.:||.|:. ||.|..:|. 
 Frog   629 GKLLTCLIGNQFRRARDGDRFYYEQ---PTVFTNAQRASIERVTLARVICDNTK-ITEVPRNVFL 689

  Fly   763 --QRLRDGGNPHVDCQDLEGFHFNFEPW 788
              |..||    ...|..:.....|  ||
 Frog   690 GNQYPRD----FFPCSRIPTLDLN--PW 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 193/565 (34%)
peroxinectin_like 364..750 CDD:188655 141/403 (35%)
epxXP_002933592.2 An_peroxidase 146..682 CDD:281139 194/566 (34%)
myeloperoxidase_like 288..697 CDD:188656 152/439 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.