DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and ptgs1

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:NP_001258184.1 Gene:ptgs1 XenbaseID:XB-GENE-995315 Length:588 Species:Xenopus tropicalis

Alignment Length:660 Identity:135/661 (20%)
Similarity:236/661 (36%) Gaps:193/661 (29%)


  Fly   138 EGLQPNEVNTPSFRHYRSLSTNPEARKLARRGY---VENQATI-DIAKRFNYTKQPGRSNIGWGP 198
            |.|:|    :|:|.||          .|.|..:   :.|...| |:..|...|.   |||:    
 Frog    72 EFLRP----SPAFYHY----------ILTRFKWFWDIINSTFIRDVIVRLVLTV---RSNL---- 115

  Fly   199 KIVLPDPTVLRLECDFNARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGR 263
               :|.|..      :|:.|    |..:.:.:      |.|.|...|.|...|....| :...|:
 Frog   116 ---IPSPPT------YNSAY----GYISWEAY------SNVSYFTRVLPPVPDDCPTP-MGTKGK 160

  Fly   264 --LPPAR-QVSLKIHRSSYETDSNFT-VMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQ 324
              ||.|. .|...:.|..:..|...| ::.|.|.|...|.                         
 Frog   161 MELPDASLLVETFLKREKFIPDPQGTNLLFAFFAQHFTHQ------------------------- 200

  Fly   325 HPECYPVDILPDDPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQ 389
                          ::|.|......|::.       ||..         :|.|.:||:..:||:.
 Frog   201 --------------FFKTYGRMGRGFIKG-------FGHG---------VDLSHIYGDSLERQHM 235

  Fly   390 LRSFINGSLRMFVTDDGRQLLPISSNPA-----DGCNRVQMTRLGKYCFESGDDRANENLL--LT 447
            ||.|.:|.|:..:.:.......:...|.     |...:.:...:|:..|         .||  |.
 Frog   236 LRLFTDGKLKYQIINGDIYPPTVVEAPVFMIYPDNVPKEKQFAVGQEVF---------GLLPGLM 291

  Fly   448 SMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLL 512
            ....||.|.||.:...|::::|.|:||:|:|..|.||..:...|...:::..|.|.       .|
 Frog   292 MYATLWLREHNRVCDILKKEHPTWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGY-------YL 349

  Fly   513 PAKHNLNAPDTYDPEVDPSIANCFAAAAFRFA-------------HTLLPGLFNISRDNSTPEAI 564
            ..|        :|||:       .....|::.             |.|:|..|.|..|..:..  
 Frog   350 KLK--------FDPEL-------LFGVQFQYRNRIAVEFNQLYHWHPLIPEKFQILEDEYSHS-- 397

  Fly   565 ELHKMLFNPFSLWAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLN 629
               :.|:|. |:..::|:: ||:.:           |:.::..|:  |..::..|  ||..|:..
 Frog   398 ---RFLYNT-SILLDYGVE-ALVES-----------FTKQIAGKI--GGGKNHHP--GLLKVAAG 442

  Fly   630 -IQRGRDHGIPSYPVFRRHCRLPTVDTWEEMS-QAIDNATLDSIRQIYESPQDVDVYTGALSEPP 692
             |:..|...:..:..:|:...|....:::::: :.|.:|.|:   ::|.....::.|.|.|.|..
 Frog   443 VIEESRKLRLQPFNEYRKRFGLKAYKSFKDLTGEEIMSAQLE---ELYGDIDALEFYLGLLLEKS 504

  Fly   693 LDGAIFGPLLSCMVSDQFLRLKLGD-----SHWYERKMGPQK-FTKAQLAEIYKTSLAAIICRNS 751
            ...:|||..:..:.:...|:..:|:     .:|.....|.:. |...:.|.|.|     ::|.|.
 Frog   505 NPNSIFGESMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGETGFNIVKTATIQK-----LVCLNV 564

  Fly   752 DGITRVREHV 761
            .....|..||
 Frog   565 KQCPFVAFHV 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 112/569 (20%)
peroxinectin_like 364..750 CDD:188655 85/414 (21%)
ptgs1NP_001258184.1 EGF_CA 25..62 CDD:238011
prostaglandin_endoperoxide_synthase 82..568 CDD:188648 127/639 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.