DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and mpo

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_002935236.3 Gene:mpo XenbaseID:XB-GENE-482502 Length:738 Species:Xenopus tropicalis

Alignment Length:611 Identity:203/612 (33%)
Similarity:306/612 (50%) Gaps:61/612 (10%)


  Fly   215 NARYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPRVSHHGR------LPPARQVS-- 271
            |:|||..||.|||::.| .:|.|..||.|::...|.|..:.||.....|      ||.||.||  
 Frog   156 NSRYRTFTGECNNRRFP-NFGVSNRPYTRLLPAQYEDSRSLPRGWTENRRINGFMLPLARAVSNQ 219

  Fly   272 -LKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEG--ESIDCCVAATREQHPECYPVDI 333
             |:........|:..::|...:||::|||:.....|.::..  :.|||..:..:|.  .|:|:.|
 Frog   220 ILQFPEREQTLDNQRSLMFMQWGQWIDHDVDLAPETPARSSFLKGIDCDHSCAKEL--PCFPLRI 282

  Fly   334 LPDDPYYKQYNISCMNFVRSAPA--PTGRFGPRM-QLNQATAFIDASVVYGNLEQRQNQLRSFIN 395
            .|:||.. |....|:...||:||  |    ||.: |:|..|:::|||.|||:.......||:...
 Frog   283 PPNDPRI-QNRSDCIPLFRSSPACVP----GPVLEQINVLTSYVDASQVYGSTNDLARMLRNNTA 342

  Fly   396 GSLRMFV-----TDDGRQLLPISSNPADGCNRVQMTRLGKYCFESGDDRANENLLLTSMHLLWAR 455
            |.|.:..     ||.|...||.|:...|.|.....|. |..||.:||.|.:|...||:.|.::.|
 Frog   343 GQLGLMAVNTRFTDGGLPYLPFSTMKEDFCVLTNETS-GLPCFLAGDARVSEQPGLTAFHTIFVR 406

  Fly   456 HHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNA 520
            .||.:||:|:..||:|..|.::||||||:||....|.|.::||:|||.::..   :||..     
 Frog   407 EHNRIARELRRINPNWTGEIIFQEARKIVGAVEQKINYKDYLPLLLGSSMPR---VLPRY----- 463

  Fly   521 PDTYDPEVDPSIANCFAAAAFRFAHTLL-PGLFNI---SRDNSTPEAIELHKMLFNPFSLWAEHG 581
             .||:..|:|..:|.| :..||..||:: |.:|.:   .|.:|:...:.||...||.:.:..|.|
 Frog   464 -TTYNDSVNPGASNVF-SLVFRMGHTMIQPFIFRLVDGYRASSSLPPVPLHLTFFNTWRVILEGG 526

  Fly   582 IDHAL--MTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSYPVF 644
            :|..|  :.|....:....:....::|..|||     .....||||.::|:|||||||:|.|..|
 Frog   527 VDPLLRGLIANKAKLNTQTQILVTQLTDHLFE-----LFKRLGLDLGAINMQRGRDHGLPGYNAF 586

  Fly   645 RRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVSD 708
            ||.|.|.......|::..:.|..| ..:..:|.:|.::|::.||::||.:.....|.||:|::.|
 Frog   587 RRLCGLSQPRNESELAAVLRNNQLAQKLISLYGTPDNIDIWMGAVAEPLITNGRVGELLACLIGD 651

  Fly   709 QFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHVMQRLRDGGNP-- 771
            ||.|.:.||..:|||   ...||.|||..|.:.|||.|:|.|    ||:.|......:....|  
 Frog   652 QFRRTRDGDRFYYER---ASVFTPAQLRSIERASLARIVCDN----TRITEVPRDVFKANNYPAN 709

  Fly   772 HVDCQDLEGFHFNFEPWSEKQQPQDL 797
            .|.|..:..  .:..||..::..::|
 Frog   710 FVRCSSIPA--LDLSPWRRRRGGEEL 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 192/563 (34%)
peroxinectin_like 364..750 CDD:188655 139/399 (35%)
mpoXP_002935236.3 An_peroxidase 159..691 CDD:281139 192/563 (34%)
myeloperoxidase_like 301..711 CDD:188656 150/437 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.