DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cd and tpo

Sequence 1:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster
Sequence 2:XP_002936348.2 Gene:tpo XenbaseID:XB-GENE-920152 Length:862 Species:Xenopus tropicalis

Alignment Length:702 Identity:232/703 (33%)
Similarity:350/703 (50%) Gaps:109/703 (16%)


  Fly   167 RRGYV------ENQATIDIAKRFNYTKQPGRSNIGWGPKIVLPD-----PTVLRLECDFN---AR 217
            ||.::      .|.:..|......:.:....|:.|...:.||.:     |..|...|..|   .:
 Frog    25 RRNHIYKITQERNSSQTDKTSLEQHPESEDVSHTGSSFEAVLANLTGCVPQTLSPFCPNNCLAGK 89

  Fly   218 YRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPR-----VSHHG-RLPPARQVSLK-IH 275
            ||..||.|||:.:| .:||:.....|.:...|.|||..|:     ..::| |||..|:|:.| ||
 Frog    90 YRHITGACNNRNNP-AWGAANTLLARWLPAQYEDGIGEPKGWREEFLYNGFRLPQVREVTNKIIH 153

  Fly   276 RSS--YETDSNFTVMLAVFGQFMDHDITATSLTTSQEGE--SIDCCVAATREQHPECYPVDILPD 336
            .||  :..|..::.::..:||::||||..|..:.|:...  |:||  .:|.|....|||:.:..:
 Frog   154 ASSKAFREDDLYSHIIIEWGQYIDHDIAFTPQSVSKTPAIGSVDC--KSTCENLYPCYPIKLSEE 216

  Fly   337 DPYYKQYNISCMNFVRSAPA-PTGRFG----------PRMQLNQATAFIDASVVYGNLEQRQNQL 390
            ||..:.   .|:.|.||:.| .|||.|          ||.|:|..|:|||||.|||:.|..|::|
 Frog   217 DPLSQG---GCIPFYRSSSACGTGRGGLKFGNPSLLNPREQINGLTSFIDASTVYGSSESLQHKL 278

  Fly   391 RSFIN--GSLRMFV--TDDGRQLLPISS------NP-ADGCNRVQMTRLGKYCFESGDDRANENL 444
            ::..:  |.||:.|  :|..|:.||..:      :| ||...|:.       ||.:|:.||||.:
 Frog   279 KNLSSEEGLLRVNVKYSDSSREYLPFETPSACMQDPTADNAERID-------CFFAGEGRANEVI 336

  Fly   445 LLTSMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGK-----N 504
            .|.::|.||.|.||.:|:.|::.||||..|..|||||||:||....||:.:::|.:|||     .
 Frog   337 TLAAVHTLWLREHNRIAKALKKLNPHWNSETTYQEARKIVGALHQIITFRDYMPKILGKAAYDQY 401

  Fly   505 ISEAKGLLPAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAHTLLPGLFNISRDNS----TPE--A 563
            |...||             |:.:.:|||:|.|..|||||.|..:|.:  :.|.||    .|:  :
 Frog   402 IGLYKG-------------YNQKTNPSISNIFTTAAFRFGHATIPPM--VHRLNSQYVDDPKYPS 451

  Fly   564 IELHKMLFNPFSLWAEHGID---HALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDL 625
            :.|:::.|.|:.:..|.|:|   ..|:..:.....||| ..:.|:|:||...|...     .:||
 Frog   452 LPLNEVFFRPWRIVKEGGLDPLIRGLLGKSAKLQTQVD-MINEELTEKLLVMTNNG-----SMDL 510

  Fly   626 VSLNIQRGRDHGIPSYPVFRRHCRLPTVDTWEEMSQAI-DNATLDSIRQIYESPQDVDVYTGALS 689
            .|||:|||||||:|.|..:|..|.|..:.|..::..|: |...:..:..:|..|.::||:.|.|:
 Frog   511 ASLNLQRGRDHGLPGYNDWREFCGLSRLATPADLINAVSDQKLVAKMIALYSHPDNIDVWLGGLA 575

  Fly   690 EPPLDGAIFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGI 754
            |..|.||..|||.:|::..|...|:.||..|||..   ..|||.|.:|:.|.||:.:||.|: |:
 Frog   576 EDFLPGARTGPLFACLIGKQMQALREGDRFWYENN---NIFTKIQRSELEKHSLSRVICDNT-GL 636

  Fly   755 TRVREHVMQRLRDGGNP--HVDCQDLEGFHFNFEPWSEKQQPQDLHSAGISR 804
            :.|   .:.....|..|  .|.|..:.|  .|.|.|  |:.|:...:.|..|
 Frog   637 SHV---PLDAFLLGNYPDNFVSCDSIPG--INLEAW--KESPEKGTTCGSPR 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 207/585 (35%)
peroxinectin_like 364..750 CDD:188655 149/412 (36%)
tpoXP_002936348.2 An_peroxidase 90..634 CDD:281139 206/581 (35%)
thyroid_peroxidase 106..669 CDD:188657 209/607 (34%)
CCP 677..726 CDD:153056 2/6 (33%)
EGF_CA 728..771 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.