DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HB40

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001329011.1 Gene:HB40 / 829827 AraportID:AT4G36740 Length:217 Species:Arabidopsis thaliana


Alignment Length:100 Identity:34/100 - (34%)
Similarity:47/100 - (47%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DQWLQNEAPTGQ-ELPSQRSK------LRAISSN---RKERTAFSKTQLKQLEAEFCYSNYLTRL 114
            |.:.|...|.|: :.|.:|.|      ..|...|   ||.:  .:..|:..||..|...:.|...
plant    19 DVYTQIVQPVGEVKQPKRRRKKTKGSVASADGGNGLFRKRK--LTDEQVNMLEMSFGDEHKLESE 81

  Fly   115 RRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQ 149
            |:..:|..|.|..|||.|||||||.:.|..:|||:
plant    82 RKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 19/51 (37%)
HB40NP_001329011.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.