DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and uncx

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_005164261.1 Gene:uncx / 798510 ZFINID:ZDB-GENE-080509-1 Length:483 Species:Danio rerio


Alignment Length:108 Identity:35/108 - (32%)
Similarity:56/108 - (51%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SASSSYADYNKLETNWC--NEANDQW-LQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQ 100
            |.::|..:.|.|.::.|  |..|.|: |.:.....::.|.        ...|:.||.|:..||::
Zfish    58 SCTASVVNSNPLLSSGCGMNGDNQQYKLTDSGDPDKDSPG--------CKRRRTRTNFTGWQLEE 114

  Fly   101 LEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            ||..|..|:|.....|..:|:.|:|.|.:|:|||||||.|.::
Zfish   115 LEKAFNESHYPDVFMREALALRLDLIESRVQVWFQNRRAKWRK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 24/51 (47%)
uncxXP_005164261.1 Homeobox 103..156 CDD:278475 24/52 (46%)
DUF3381 <154..212 CDD:288694 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.