DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and NK7.1

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001247103.1 Gene:NK7.1 / 41747 FlyBaseID:FBgn0024321 Length:721 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:54/130 - (41%) Gaps:41/130 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 APTGQELPSQRSKLRAISSN-----------------------------------RKERTAFSKT 96
            :|||......|.||.|.:|:                                   :|.||.|:..
  Fly   339 SPTGSSDSLMRDKLMANNSSSPGSNVNAQMQSNANSTLETTEDDSDSGSTDARRKKKARTTFTGR 403

  Fly    97 QLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR------IKLEEQQGSSAK 155
            |:.:||..|....||:...|.|:|..|.:||.|||:||||||.|.|:      .:..|.:.|:||
  Fly   404 QIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNNEAAEHKSSNAK 468

  Fly   156  155
              Fly   469  468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 25/51 (49%)
NK7.1NP_001247103.1 Homeobox 397..449 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.