DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxb9

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_988879.1 Gene:hoxb9 / 394474 XenbaseID:XB-GENE-963094 Length:247 Species:Xenopus tropicalis


Alignment Length:114 Identity:48/114 - (42%)
Similarity:70/114 - (61%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQL 101
            |.:..:::.| |||    |..:.|     :..|.|..|| .:.|.|.|| ||:|..::|.|..:|
 Frog   145 DANERATFPD-NKL----CEGSGD-----KDRTHQSNPS-ANWLHARSS-RKKRCPYTKYQTLEL 197

  Fly   102 EAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQ 150
            |.||.::.||||.||:|:|..|.|:|||||:||||||||.|::..::.:
 Frog   198 EKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKLNKDQSK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 30/51 (59%)
hoxb9NP_988879.1 Hox9_act 1..169 CDD:368024 8/33 (24%)
Homeobox 185..239 CDD:365835 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.