DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: btn and unpg

Sequence 1:NP_732768.1 Gene:btn FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:109 Identity:40/110 (36%)
Similarity:62/110 (56%) Gaps:3/110 (3%)


  Fly    37 DHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQL 101
            |.|.:.:|.:.:..:   |::......::|........||.:...:.|.:|:.||||:..||.:|
  Fly   273 DKSRNGAYTNSDSED---CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334

  Fly   102 EAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIK 145
            |.||....||:...|.:||.:|:|:|.|||:||||||.|.||:|
  Fly   335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 28/52 (54%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.