powered by:
Protein Alignment btn and unpg
DIOPT Version :9
| Sequence 1: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_477146.1 |
Gene: | unpg / 35942 |
FlyBaseID: | FBgn0015561 |
Length: | 485 |
Species: | Drosophila melanogaster |
| Alignment Length: | 109 |
Identity: | 40/109 - (36%) |
| Similarity: | 62/109 - (56%) |
Gaps: | 3/109 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 DHSASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQL 101
|.|.:.:|.:.:..: |::......::|........||.:...:.|.:|:.||||:..||.:|
Fly 273 DKSRNGAYTNSDSED---CSDDEGAQSRHEGGGMGGKDSQGNGSSSNSKSRRRRTAFTSEQLLEL 334
Fly 102 EAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIK 145
|.||....||:...|.:||.:|:|:|.|||:||||||.|.||:|
Fly 335 EREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK 378
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
53 |
1.000 |
Domainoid score |
I4196 |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D858478at2759 |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
|
4 | 3.910 |
|
Return to query results.
Submit another query.