DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and H2.0

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_523488.2 Gene:H2.0 / 33841 FlyBaseID:FBgn0001170 Length:418 Species:Drosophila melanogaster


Alignment Length:94 Identity:36/94 - (38%)
Similarity:47/94 - (50%) Gaps:10/94 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTER 128
            |..|..|.....:||..||:         ||..|.|.||.:|....|:|:..|.::|..|.||:.
  Fly   282 QGNASAGSNGKRKRSWSRAV---------FSNLQRKGLEIQFQQQKYITKPDRRKLAARLNLTDA 337

  Fly   129 QVKVWFQNRRMKCKRIKLEEQQGSSAKTP 157
            ||||||||||||.:..: |..:....|.|
  Fly   338 QVKVWFQNRRMKWRHTR-ENLKSGQEKQP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 26/51 (51%)
H2.0NP_523488.2 Homeobox 298..351 CDD:278475 28/61 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.