DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and OdsH

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:103 Identity:33/103 - (32%)
Similarity:45/103 - (43%) Gaps:26/103 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEF 105
            |...||.| |..|.|.|:                         |..|:.||.|:..||::||..|
  Fly   139 SDEGADSN-LGQNDCTES-------------------------SKKRRGRTNFNSWQLRELERVF 177

  Fly   106 CYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
            ..|:|.....|..:|..|:|.|.::.|||||||.|.::
  Fly   178 QGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 23/51 (45%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I2937
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.