DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and HOXA9

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_689952.1 Gene:HOXA9 / 3205 HGNCID:5109 Length:272 Species:Homo sapiens


Alignment Length:159 Identity:56/159 - (35%)
Similarity:75/159 - (47%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KSWLNQTEGYT-----------------------DCSYVYDHSAS-SSYA------DYNKLETNW 54
            :|||..|.|..                       ||..:..|:.| :.||      |..|..:..
Human   109 RSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEG 173

  Fly    55 CNEANDQWLQNEAPTGQELPSQRSKLRA----ISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLR 115
            ....|:  .:||: .|.:.|...:...|    ..|.||:|..::|.|..:||.||.::.||||.|
Human   174 AFSENN--AENES-GGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDR 235

  Fly   116 RYEIAVALELTERQVKVWFQNRRMKCKRI 144
            |||:|..|.|||||||:||||||||.|:|
Human   236 RYEVARLLNLTERQVKIWFQNRRMKMKKI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 32/51 (63%)
HOXA9NP_689952.1 Hox9_act 1..193 CDD:309661 18/86 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..198 9/45 (20%)
Homeobox 209..262 CDD:306543 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.