powered by:
Protein Alignment btn and HOXA6
DIOPT Version :9
| Sequence 1: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_076919.1 |
Gene: | HOXA6 / 3203 |
HGNCID: | 5107 |
Length: | 233 |
Species: | Homo sapiens |
| Alignment Length: | 60 |
Identity: | 34/60 - (56%) |
| Similarity: | 44/60 - (73%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 SSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKR 143
|..|:.|..:::.|..:||.||.::.||||.||.|||.||.|||||:|:||||||||.|:
Human 153 SHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKK 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0489 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X14 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.