DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and ALX3

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:93 Identity:34/93 - (36%)
Similarity:50/93 - (53%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKV 132
            |...||...:||      .|:.||.||..||::||..|..::|.....|.::|:..:|||.:|:|
Human   141 PDSMELAKNKSK------KRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQV 199

  Fly   133 WFQNRRMKCKRIKLEEQQG--SSAKTPF 158
            ||||||.|.::   .|:.|  ...:.||
Human   200 WFQNRRAKWRK---RERYGKIQEGRNPF 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 24/51 (47%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
PRK12323 <13..131 CDD:237057
Homeobox 157..210 CDD:365835 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.