powered by:
Protein Alignment btn and ceh-17
DIOPT Version :9
| Sequence 1: | NP_732768.1 |
Gene: | btn / 42664 |
FlyBaseID: | FBgn0014949 |
Length: | 158 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_491393.1 |
Gene: | ceh-17 / 172059 |
WormBaseID: | WBGene00000440 |
Length: | 237 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 82 |
Identity: | 36/82 - (43%) |
| Similarity: | 50/82 - (60%) |
Gaps: | 12/82 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 PSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRR 138
|::|.|.|.| ||.|:..|||:||..||.::|.....|.|||:.::|||.:|:|||||||
Worm 143 PAERRKQRRI------RTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRR 201
Fly 139 M------KCKRIKLEEQ 149
. |.:|:|.||:
Worm 202 AKYRKQEKIRRVKDEEE 218
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| btn | NP_732768.1 |
Homeobox |
90..142 |
CDD:278475 |
27/57 (47%) |
| ceh-17 | NP_491393.1 |
DLL_N |
20..112 |
CDD:403572 |
|
| Homeobox |
153..206 |
CDD:395001 |
26/52 (50%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.