DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and AgaP_AGAP005281

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_309065.4 Gene:AgaP_AGAP005281 / 1270404 VectorBaseID:AGAP005281 Length:602 Species:Anopheles gambiae


Alignment Length:95 Identity:34/95 - (35%)
Similarity:48/95 - (50%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTE 127
            |..|..|...:||...:      .:|.||.|:..|:.:||.:|....||:...|.|:|..|.:||
Mosquito   365 LTEEETTTTSVPSHHRR------KKKARTTFTGRQIFELEKQFEVKKYLSSNERTEMAKLLNVTE 423

  Fly   128 RQVKVWFQNRRMKCKRIKLEEQQGSSAKTP 157
            .|||:||||||.|.|:    :....|.:.|
Mosquito   424 TQVKIWFQNRRTKWKK----QDTAGSGEVP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 25/51 (49%)
AgaP_AGAP005281XP_309065.4 Homeobox 386..438 CDD:278475 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.