DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and lmtk2

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_002932018.3 Gene:lmtk2 / 100489240 XenbaseID:XB-GENE-980913 Length:1419 Species:Xenopus tropicalis


Alignment Length:198 Identity:41/198 - (20%)
Similarity:64/198 - (32%) Gaps:71/198 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YQESYCYEDITKS---W-LNQT--EGYTDCSYVYDHSASSS---------------------YAD 46
            ||:.....|.|||   | |..|  |.:.:.:..|:..:.|.                     |||
 Frog   314 YQDQLLVADQTKSSNIWSLGVTLWELFENAATPYEDLSDSEVLAQVIKQREVKLPNPQLEQPYAD 378

  Fly    47 --YNKLETNWCNEANDQWL--------------QNEAPTGQELPSQRSKLRAISSNRKERT---- 91
              |..|:..|.  .:|:.|              |::..|..:...:.:.|:..:|||:..|    
 Frog   379 RWYEVLQFCWL--TSDKRLTAEEVHRLLTYLRMQSQKETEDDFEQRWNSLKPNTSNRQASTNNLA 441

  Fly    92 -----AFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151
                 .||..:|.|                 |:...|.:||....:.|:......|....|||..
 Frog   442 FPILEHFSGDELSQ-----------------EMDEVLTVTETSQGLSFEYVWEAAKEDHFEEQGH 489

  Fly   152 SSA 154
            |.:
 Frog   490 SDS 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 10/60 (17%)
lmtk2XP_002932018.3 PTKc_Aatyk2 136..406 CDD:270669 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.