DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and arxb

DIOPT Version :10

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:156 Identity:45/156 - (28%)
Similarity:68/156 - (43%) Gaps:27/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YEDITKSWLNQTEG------------YTDCSYV-------YDHSASSSYADYNKLE-TNWCNEAN 59
            :..:|.|..::|.|            .|:.|.|       |...||......|:.| .:.|.|.|
Zfish    64 FAPLTDSSTDETAGPRLLQTACEKLKITEASIVNISRAGSYQEHASCKNTPINEEEGADICGETN 128

  Fly    60 -------DQWLQNEAPTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRY 117
                   :.:|:|...|.....|...........|:.||.|:..||::||..|..::|.....|.
Zfish   129 VTLKQEREAFLKNSEETSLSAGSDTEDGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTRE 193

  Fly   118 EIAVALELTERQVKVWFQNRRMKCKR 143
            |:|:.|:|||.:|:|||||||.|.::
Zfish   194 ELAMRLDLTEARVQVWFQNRRAKWRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeodomain 87..143 CDD:459649 26/55 (47%)
arxbXP_002667096.1 Homeodomain 163..219 CDD:459649 26/55 (47%)
OAR 351..369 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.