DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment btn and hoxd10

DIOPT Version :9

Sequence 1:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_031749087.1 Gene:hoxd10 / 100038085 XenbaseID:XB-GENE-485204 Length:274 Species:Xenopus tropicalis


Alignment Length:163 Identity:48/163 - (29%)
Similarity:85/163 - (52%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NSHANVYQESYCYEDITKSWLNQTEGYTDCSYVYDHSASSSY--------ADYNKLETNWCNEA- 58
            |.|.....:|..|..:.::.: ..:|:   ...||.|.:..|        |..:...||...:| 
 Frog   111 NHHGPPSSQSNFYSSVGRNGI-LPQGF---DQFYDSSQNQGYQVGMEEQPAKSDPKATNAPTKAP 171

  Fly    59 --NDQWLQNEA----PTGQELPSQRSKLRAISSNRKERTAFSKTQLKQLEAEFCYSNYLTRLRRY 117
              .|:.:.|::    |:|:   :::|...|....||:|..:||.|:::||.||.::.|:.:.:|.
 Frog   172 STQDKKVTNDSSPGTPSGE---AEKSNSSASQRLRKKRCPYSKYQIRELEREFFFNVYINKEKRL 233

  Fly   118 EIAVALELTERQVKVWFQNRRMKCKRIKLEEQQ 150
            :::..|.||:||||:||||||||.|::..:..|
 Frog   234 QLSRMLNLTDRQVKIWFQNRRMKEKKLNRDRLQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
btnNP_732768.1 Homeobox 90..142 CDD:278475 25/51 (49%)
hoxd10XP_031749087.1 DUF3528 41..163 CDD:403310 10/55 (18%)
Homeobox 205..259 CDD:395001 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.