DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dph5 and DPH5

Sequence 1:NP_524452.4 Gene:Dph5 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_013273.1 Gene:DPH5 SGDID:S000004162 Length:300 Species:Saccharomyces cerevisiae

Alignment Length:272 Identity:145/273 (53%)
Similarity:195/273 (71%) Gaps:5/273 (2%)


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSIL-GCSLEDMQEFYGRPLLLADRDLVEQG 64
            |.|||||||....||||:|||.:|:|||||||.||||| ..|.|:::.:||:.::||||:|||.|
Yeast     1 MLYLIGLGLSYKSDITVRGLEAIKKCSRVYLEHYTSILMAASQEELESYYGKEIILADRELVETG 65

  Fly    65 ADEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLYKFGE 129
            :.:||..|.:.|||.||||||||||||||.:||||.:.||.::|||||:|||||.||||||.||:
Yeast    66 SKQILNNADKEDVAFLVVGDPFGATTHTDLVLRAKREAIPVEIIHNASVMNAVGACGLQLYNFGQ 130

  Fly   130 TVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAA 194
            |||:.::.:.|:|||:||||..||...:|||.||||||||.:.|::.|.|..|.|||:|::|:..
Yeast   131 TVSMVFFTDNWRPDSWYDKIWENRKIGLHTLVLLDIKVKEQSIENMARGRLIYEPPRYMSIAQCC 195

  Fly   195 HQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLIIPAKEM 259
            .|||.|.||:.:    ......:..|.::|:|..||....||:.|:.:.|.|.|||||:|..::.
Yeast   196 EQLLEIEEKRGT----KAYTPDTPAVAISRLGSSSQSFKSGTISELANYDSGEPLHSLVILGRQC 256

  Fly   260 HPLEVEFLQQYA 271
            |.||:|:|.::|
Yeast   257 HELELEYLLEFA 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 144/270 (53%)
DPH5NP_013273.1 PTZ00175 1..257 CDD:185500 139/260 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C174009568
eggNOG 1 0.900 E1_COG1798
Hieranoid 1 1.000
Homologene 1 1.000 H6471
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003877
OrthoInspector 1 1.000 T1135981
orthoMCL 1 0.900 OOG5_127443
Panther 1 1.100 LDO PTHR10882
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R340
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.