DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dph5 and AT4G31790

Sequence 1:NP_524452.4 Gene:Dph5 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_194907.1 Gene:AT4G31790 AraportID:AT4G31790 Length:277 Species:Arabidopsis thaliana

Alignment Length:276 Identity:152/277 (55%)
Similarity:204/277 (74%) Gaps:11/277 (4%)


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSIL--GCS---LEDMQEFYGRPLLLADRDL 60
            |.|:|||||||.||||::|||.||:..:||:|.|||:|  |.|   |.::::|||:|::||||::
plant     1 MLYIIGLGLGDEKDITLRGLEAVKKSQKVYMEAYTSLLSFGLSADGLSNLEKFYGKPIILADREM 65

  Fly    61 VEQGADEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLY 125
            ||:.|.:::..|.::|||.||||||||||||:|.::|||...:..:|:||||:|||||.||||||
plant    66 VEEKAGDMIDEAIDNDVAFLVVGDPFGATTHSDLVVRAKTLGVKVEVVHNASVMNAVGICGLQLY 130

  Fly   126 KFGETVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMR-KRKEYMPPRFMT 189
            .:|||||||::.|||:|||||:|||.||...:||||||||:|||||.|||.| .:|:|.|||:|:
plant   131 HYGETVSIPFFTETWRPDSFYEKIKKNRSLGLHTLCLLDIRVKEPTFESLCRGGKKQYEPPRYMS 195

  Fly   190 VAEAAHQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLII 254
            |..|..|||.:.:|    ..::|..|.:.|||.||:|.|.|.|..||:.::.|.|.|.|||.|:|
plant   196 VNTAIEQLLEVEQK----HGDSVYGEDTQCVGFARLGSEDQTIVAGTMKQLESVDFGAPLHCLVI 256

  Fly   255 PAKEMHPLEVEFLQQY 270
             ..|.||:|.|.|:.|
plant   257 -VGETHPVEEEMLEFY 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 151/275 (55%)
AT4G31790NP_194907.1 PTZ00175 1..273 CDD:185500 152/277 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6471
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1018517at2759
OrthoInspector 1 1.000 T193156
orthoMCL 1 0.900 OOG5_127443
Panther 1 1.100 LDO PTHR10882
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.