DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dph5 and Dph5

Sequence 1:NP_524452.4 Gene:Dph5 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_081469.2 Gene:Dph5 MGIID:1916990 Length:281 Species:Mus musculus

Alignment Length:271 Identity:173/272 (64%)
Similarity:212/272 (78%) Gaps:0/272 (0%)


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYGRPLLLADRDLVEQGA 65
            |.|||||||||.|||||||||:|::|||||||.|||:|....|.::|||||.|:||||:.|||.|
Mouse     1 MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREEVEQEA 65

  Fly    66 DEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLYKFGET 130
            |.|...|..||||.||||||||||||:|.||||.:..|||:|||||||||||||||||||:||||
Mouse    66 DNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIMNAVGCCGLQLYRFGET 130

  Fly   131 VSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAAH 195
            |||.:|.:||:|:||:||:|.||.:.|||||||||||||.:.|:|:|.||.|.|||:|:|.:||.
Mouse   131 VSIVFWTDTWRPESFFDKVKRNRANGMHTLCLLDIKVKEQSLENLIRGRKIYEPPRYMSVNQAAQ 195

  Fly   196 QLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLIIPAKEMH 260
            |||.||:...:..:...:.|::|||||||||.|.|:||.|||.:|.:..||.|||||:|....:|
Mouse   196 QLLEIVQNHRARGEEPAITEETLCVGLARVGAEDQKIAAGTLQQMCTVSLGEPLHSLVITGGNLH 260

  Fly   261 PLEVEFLQQYA 271
            |||:|.|..::
Mouse   261 PLEMEMLSLFS 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 173/269 (64%)
Dph5NP_081469.2 PTZ00175 1..272 CDD:185500 173/272 (64%)
S-adenosyl-L-methionine binding. {ECO:0000250} 112..113 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173997804
eggNOG 1 0.900 E1_COG1798
Hieranoid 1 1.000
Homologene 1 1.000 H6471
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003877
OrthoInspector 1 1.000 T1083292
orthoMCL 1 0.900 OOG5_127443
Panther 1 1.100 LDO PTHR10882
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R340
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.