DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dph5 and dph5

Sequence 1:NP_524452.4 Gene:Dph5 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_588441.1 Gene:dph5 PomBaseID:SPCC576.14 Length:283 Species:Schizosaccharomyces pombe

Alignment Length:280 Identity:147/281 (52%)
Similarity:202/281 (72%) Gaps:6/281 (2%)


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSILGCSLEDMQEFYGRPLLLADRDLVEQGA 65
            |||||||||.|.||||::|||.||:|.|:|||.|||||....|.::|.||:.::||||::||..:
pombe     1 MFYLIGLGLFDEKDITLRGLETVKKCQRIYLEAYTSILLVQKEKLEELYGKEVILADREMVESSS 65

  Fly    66 DEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLYKFGET 130
            ||||..|...|||:||||||.|||||.|.::||:|..||.::|||||||||:|.|||||||||:|
pombe    66 DEILKDADNCDVAMLVVGDPMGATTHADLVIRARELKIPVRMIHNASIMNAIGACGLQLYKFGQT 130

  Fly   131 VSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEAAH 195
            ||:.:::..::|.||||.||.|....:|||.||||||||.:.|:|.|.||.|.|||:|:.:.||.
pombe   131 VSLVFFENNYRPQSFYDHIKENVSLGLHTLVLLDIKVKEQSWENLARGRKVYEPPRYMSASLAAQ 195

  Fly   196 QLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLIIPAKEMH 260
            |:|.:.|.:    :..:....||||.:.|:|.:.|.|..|||.|:...|:|.||||:::..:::|
pombe   196 QMLEVEEDR----QENICTPDSLCVAVGRMGSDDQVIFAGTLQELAEHDIGPPLHSVVLVGRDVH 256

  Fly   261 PLEVEFLQQYAPSIKLDDYN 280
            .||:|||:.||  :.|::::
pombe   257 DLELEFLRAYA--VNLENFD 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 144/269 (54%)
dph5NP_588441.1 PTZ00175 1..266 CDD:185500 144/269 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6471
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003877
OrthoInspector 1 1.000 T1124806
orthoMCL 1 0.900 OOG5_127443
Panther 1 1.100 LDO PTHR10882
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R340
TreeFam 1 0.960
109.910

Return to query results.
Submit another query.