DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dph5 and B0491.7

Sequence 1:NP_524452.4 Gene:Dph5 FlyBaseID:FBgn0024558 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_496427.1 Gene:B0491.7 WormBaseID:WBGene00007194 Length:274 Species:Caenorhabditis elegans

Alignment Length:274 Identity:164/275 (60%)
Similarity:209/275 (76%) Gaps:3/275 (1%)


  Fly     1 MFYLIGLGLGDLKDITVKGLEIVKQCSRVYLEMYTSIL--GCSLEDMQEFYGRPLLLADRDLVEQ 63
            :||||||||||::|||||||.|||.|:||:||.|||||  |....::::||||.::.|||.:|||
 Worm     2 VFYLIGLGLGDVEDITVKGLNIVKNCARVHLEAYTSILCYGLDKTNLEKFYGREIIEADRTVVEQ 66

  Fly    64 GADEILAGAGESDVALLVVGDPFGATTHTDFILRAKEKNIPYKVIHNASIMNAVGCCGLQLYKFG 128
            .:|.||.||.:.||||||||||||||||.|.:||||::|||.||||||||||||||||||||.||
 Worm    67 ESDAILNGADKEDVALLVVGDPFGATTHADLVLRAKQQNIPVKVIHNASIMNAVGCCGLQLYNFG 131

  Fly   129 ETVSIPYWDETWKPDSFYDKIKLNRLHNMHTLCLLDIKVKEPTPESLMRKRKEYMPPRFMTVAEA 193
            |||||..|.:.|:|:|:||||.|||...||||||||||.||.|.|::||.||.:.|.|:...:||
 Worm   132 ETVSIVMWTDEWQPESYYDKIALNRKRGMHTLCLLDIKTKEQTVENMMRGRKIFEPARYQKCSEA 196

  Fly   194 AHQLLSIVEKKDSLEKNTVLNEQSLCVGLARVGQESQQIAVGTLLEMRSTDLGGPLHSLIIPAKE 258
            |.|||:|.|::.:..:....:|.::.|||||||.::|:|...::.:|...::|.||||||||. |
 Worm   197 ARQLLTIYERRKAKGEECAYDENTMVVGLARVGWDNQKIVYASMKDMSEMEMGEPLHSLIIPG-E 260

  Fly   259 MHPLEVEFLQQYAP 272
            .|||||:.|:.:.|
 Worm   261 THPLEVDMLETFRP 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dph5NP_524452.4 PTZ00175 1..270 CDD:185500 163/271 (60%)
B0491.7NP_496427.1 PTZ00175 1..273 CDD:185500 163/272 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173991060
eggNOG 1 0.900 E1_COG1798
Hieranoid 1 1.000
Homologene 1 1.000 H6471
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1018517at2759
OrthoFinder 1 1.000 FOG0003877
OrthoInspector 1 1.000 T476552
orthoMCL 1 0.900 OOG5_127443
Panther 1 1.100 LDO PTHR10882
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R340
TreeFam 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.