DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSN6 and eIF3f1

Sequence 1:NP_524451.1 Gene:CSN6 FlyBaseID:FBgn0028837 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_649489.1 Gene:eIF3f1 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster

Alignment Length:271 Identity:62/272 (23%)
Similarity:119/272 (44%) Gaps:20/272 (7%)


  Fly    51 SVTISLHPLVIMNISEHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDVIGDETVINK 115
            ::|:.:||:|:..:.:   .|..::.:..:|.|.|:|......:|:.|.|.:......|:.....
  Fly     5 NLTVRVHPVVLFQVVD---AFERRNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAEL 66

  Fly   116 DYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSVD----- 175
            .|........::|.|:...:||:.||::.|.....|....|  .||.     ||:..:||     
  Fly    67 SYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYA--RECN-----NPVHLTVDTSLQG 124

  Fly   176 -HLPLKLFESL-IDLVDGEATMLFVPLTYTLATEEAERIGVDHVARM--TSNESGEKSVVAEHLV 236
             .:.|:.:..: :.:..|::..:|.|:...|.:.|.|..|:..:.:.  .|.....|:|.....:
  Fly   125 GRMGLRAYVCIQLGVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKTVGVSPAHRPKTVPPMLDL 189

  Fly   237 AQDS-AIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDV 300
            ||.| |...|.:.:.::|:|:.||.|.|:..:..:.|:...|.|.:|.|....|.:.|.....::
  Fly   190 AQISEASTKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNL 254

  Fly   301 GLISYLGTLTK 311
            .|:..|..|.|
  Fly   255 LLVITLSQLIK 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSN6NP_524451.1 MPN_CSN6 52..335 CDD:163694 62/271 (23%)
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 61/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C13149723
eggNOG 1 0.900 E1_COG1310
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10540
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.