DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA20OX4

DIOPT Version :8

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_176294.1 Gene:GA20OX4 / 842389 AraportID:AT1G60980 Length:376 Species:Arabidopsis thaliana

Alignment Length:309 Identity:74/310 (24%)
Similarity:124/310 (40%) Gaps:62/310 (20%)


  Fly     9 LLQNAVPIIDLEN-------TIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLT 66
            :||  ||:|||..       .:.:....:.||..:.|:.|:.|||:....:..|.|..|.|....
plant    54 ILQ--VPVIDLAGFLSNDPLLVSEAERLVSEAAKKHGFFLVTNHGVDERLLSTAHKLMDTFFKSP 116

  Fly    67 DEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRHINSLV 131
            :..||..:|..   ||..||.|..:.||....|...      .|...|.|.::...:|:.:.:.:
plant   117 NYEKLKAQRKV---GETTGYASSFVGRFKENLPWKE------TLSFSFSPTEKSENYSQTVKNYI 172

  Fly   132 -----DDFNELGRF--------------ILKALAISLDAP----PSFFTDKHSFMLSDDRFNLTT 173
                 |.:.:.|..              |::.|.:||...    ..||.|..|.           
plant   173 SKTMGDGYKDFGSVYQEYAETMSNLSLKIMELLGMSLGIKREHFREFFEDNESI----------- 226

  Fly   174 LRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINC 238
            .|:.:||..:..|   ..:..|.|.|..:.|:|.||...||:|.:  .::|:.:..:|.||.:|.
plant   227 FRLNYYPKCKQPD---LVLGTGPHCDPTSLTILQQDQVSGLQVFV--DNQWQSIPPIPQALVVNI 286

  Fly   239 GETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            |:|:...|:..|.:..||.|:..:..     |.::|:|..|....::.|
plant   287 GDTLMALTNGIYKSCLHRAVVNGETT-----RKTLAFFLCPKVDKVVKP 330

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/304 (23%)
DIOX_N 14..107 CDD:290926 27/100 (27%)
2OG-FeII_Oxy 179..279 CDD:281202 28/100 (28%)
GA20OX4NP_176294.1 PLN02276 16..376 CDD:215156 74/310 (24%)
DIOX_N 57..159 CDD:290926 30/111 (27%)
2OG-FeII_Oxy 223..322 CDD:281202 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2123
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10209
Phylome 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.