DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AOP3

DIOPT Version :8

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001319854.1 Gene:AOP3 / 828104 AraportID:AT4G03050 Length:411 Species:Arabidopsis thaliana

Alignment Length:96 Identity:26/97 (27%)
Similarity:45/97 (46%) Gaps:6/97 (6%)


  Fly   196 AHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRVVIP 260
            :|.|.....::.|....|||||.: ..||.||...|..:.:..|:.:....:....:..|||   
plant   278 SHTDKSLTGIIYQHQIDGLEVKTK-EGKWIRVKPAPNTVIVIAGDALCALMNGRIPSPYHRV--- 338

  Fly   261 DQVDIRHRGRHSIAYFCHPDNSALI-NPKDL 290
             :|..:.:.|::.|.|.:|....:| :||:|
plant   339 -RVTEKKKTRYAAALFSNPKEGYIIDSPKEL 368

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 23/92 (25%)
DIOX_N 14..107 CDD:290926
2OG-FeII_Oxy 179..279 CDD:281202 21/83 (25%)
AOP3NP_001319854.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10209
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.