DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G61400

DIOPT Version :8

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_191699.1 Gene:AT3G61400 / 825312 AraportID:AT3G61400 Length:370 Species:Arabidopsis thaliana

Alignment Length:274 Identity:65/275 (24%)
Similarity:111/275 (40%) Gaps:34/275 (12%)


  Fly     1 MKSETETLLLQNAVPIIDLENTI-----EDVATNLREALSEK--------GYALLINHGISNEKI 52
            :.|....|.||..:|.|||...:     :|..|  |.::.||        |:..::||||..:.:
plant    47 LASRKPPLALQFTIPTIDLNGGVVYYKNQDSVT--RRSMVEKIGDAAEKWGFFQVVNHGIPLDVL 109

  Fly    53 KKAWKYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLP- 116
            :|..:....|.:...|:|   :|..:.|..........::.|.......|.  .:|.......| 
plant   110 EKVKEGIRAFHEQDAELK---KRFYSRDHTRKMVYYSNLDLFTAMKASWRD--TMCAYMAPDPPT 169

  Fly   117 EQQLPGFSRHI-NSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSD-DRFNLTTLRMLFY 179
            .:.||.....| .....:...||..|.:.|:.:|..       .:|..|.| |......|...:|
plant   170 SEDLPEVCGEIMMEYAKEIMNLGELIFELLSEALGL-------NNSNHLKDMDCSKSLVLFGQYY 227

  Fly   180 PPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAI 244
            ||....||   .:....|.|:...|::.|.:.|||:| |.....|..:..:||||.:|.|:.:.:
plant   228 PPCPQPDH---TLGLSKHTDFSFLTIVLQGNLGGLQV-LHDKQYWIDIPPVPGALVVNLGDLLQL 288

  Fly   245 WTDQFYHALQHRVV 258
            .::..:.:::|||:
plant   289 ISNGKFISVEHRVI 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 61/263 (23%)
DIOX_N 14..107 CDD:290926 22/106 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 24/81 (30%)
AT3G61400NP_191699.1 PLN02393 15..351 CDD:215220 65/275 (24%)
DIOX_N 60..175 CDD:290926 26/122 (21%)
2OG-FeII_Oxy 226..317 CDD:281202 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2123
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10209
Phylome 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.