DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT3G19000

DIOPT Version :8

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_566623.1 Gene:AT3G19000 / 821433 AraportID:AT3G19000 Length:352 Species:Arabidopsis thaliana

Alignment Length:312 Identity:88/313 (28%)
Similarity:131/313 (42%) Gaps:64/313 (20%)


  Fly     9 LLQNAVPIID---LENTIED---VATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTD 67
            :..:.:|.||   ||:|..|   :|..:.||....|:..:||||:.:....:..|....|.:||.
plant    27 IFSDEIPTIDLSSLEDTHHDKTAIAKEIAEACKRWGFFQVINHGLPSALRHRVEKTAAEFFNLTT 91

  Fly    68 EVKLAFERSKA-----PDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFL------PE---- 117
            |.|...:|.:.     .|.|:...|....|.||            ..|||..:      ||    
plant    92 EEKRKVKRDEVNPMGYHDEEHTKNVRDWKEIFD------------FFLQDSTIVPASPEPEDTEL 144

  Fly   118 ----QQLPGFSRHINSLVDDF----NELGRFILKALAISLDAP----PSFFTDKHSFMLSDDRFN 170
                .|.|....|...:..::    .:|...:|:.::|||..|    ..||.::.||:    |||
plant   145 RKLTNQWPQNPSHFREVCQEYAREVEKLAFRLLELVSISLGLPGDRLTGFFNEQTSFL----RFN 205

  Fly   171 LTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALF 235
                   .|||..:.:..   :..|.|.|....|:|||||.|||:|..|...:|..|..:..||.
plant   206 -------HYPPCPNPELA---LGVGRHKDGGALTVLAQDSVGGLQVSRRSDGQWIPVKPISDALI 260

  Fly   236 INCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            ||.|..:.:||:..|.:.:||||:...     :.|.||.:|..|.:.|.|.|
plant   261 INMGNCIQVWTNDEYWSAEHRVVVNTS-----KERFSIPFFFFPSHEANIEP 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 87/307 (28%)
DIOX_N 14..107 CDD:290926 28/104 (27%)
2OG-FeII_Oxy 179..279 CDD:281202 35/100 (35%)
AT3G19000NP_566623.1 PLN02750 1..352 CDD:178351 88/313 (28%)
DIOX_N 32..152 CDD:290926 34/132 (26%)
2OG-FeII_Oxy 196..290 CDD:281202 36/113 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2123
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10209
Phylome 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.