DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and TOX4

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_055643.1 Gene:TOX4 / 9878 HGNCID:20161 Length:621 Species:Homo sapiens


Alignment Length:106 Identity:28/106 - (26%)
Similarity:48/106 - (45%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||:||:.|:...| :..||.::|:.:..|||.....||.::.:|.|.|::.....|..||.:.
Human   223 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 286

  Fly    73 LKQWNFPKEHRFSDTQCICSSNTNQCPTLFVYDTMDDSMTP 113
            |..:.       .:.:|..:..|.:      .|....|.||
Human   287 LAAYK-------DNQECQATVETVE------LDPAPPSQTP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/67 (33%)
TOX4NP_055643.1 NHP6B 140..>306 CDD:227935 24/96 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..227 2/3 (67%)
Nuclear localization signal. /evidence=ECO:0000255 213..218
HMG-box_TOX-like 224..293 CDD:438811 21/76 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..333 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.