DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb2

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_032278.1 Gene:Hmgb2 / 97165 MGIID:96157 Length:210 Species:Mus musculus


Alignment Length:68 Identity:27/68 - (39%)
Similarity:40/68 - (58%) Gaps:5/68 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||:|.|||.|:. |..|..||.|||..|:.:.:.|.||||...:.:||..:::.|    |:.|||
Mouse    95 PKRPPSAFFLFC-SENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKA----AKLKEK 154

  Fly    73 LKQ 75
            .::
Mouse   155 YEK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 27/68 (40%)
Hmgb2NP_032278.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..102 4/6 (67%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 27/68 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.