DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and NHP10

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_010282.3 Gene:NHP10 / 851562 SGDID:S000002160 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:14/72 - (19%)
Similarity:38/72 - (52%) Gaps:9/72 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLW--MNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            ||:|.:|::|:  ||   ::.|: ::....|.....:|   |:.:.::|:..:.:..:.....|:
Yeast    94 PKRPTNAYLLYCEMN---KERIR-QNGSLDVTRDLAEG---WKNLNEQDRKPYYKLYSEDRERYQ 151

  Fly    71 EKLKQWN 77
            .:::.:|
Yeast   152 MEMEIYN 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 13/69 (19%)
NHP10NP_010282.3 NHP6B 24..203 CDD:227935 14/72 (19%)

Return to query results.
Submit another query.