DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and AT1G76110

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_177738.1 Gene:AT1G76110 / 843943 AraportID:AT1G76110 Length:338 Species:Arabidopsis thaliana


Alignment Length:71 Identity:16/71 - (22%)
Similarity:35/71 - (49%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKH--IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            ||...|.:..:.   ..||  :|:.:|: ..:|.:...||.|..::.|:::|:|:........|:
plant   255 PKPNRSGYNFFF---AEKHCKLKSLYPN-KEREFTKLIGESWSNLSTEERMVYQDIGLKDKERYQ 315

  Fly    71 EKLKQW 76
            .:|.::
plant   316 RELNEY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 16/69 (23%)
AT1G76110NP_177738.1 ARID_HMGB9-like 40..125 CDD:350636
HMG-box_AtHMGB9-like 255..321 CDD:438825 16/69 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.