DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and HMGB1

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_974413.1 Gene:HMGB1 / 824351 AraportID:AT3G51880 Length:185 Species:Arabidopsis thaliana


Alignment Length:72 Identity:22/72 - (30%)
Similarity:42/72 - (58%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RPKKPMSAFMLWMNSTGRKHIKAEHPDF-SVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYK 70
            :||:..|||.:::... |...|.|:|:. :|..|...||:.|::|:..:|..::|.|....|||:
plant    52 KPKRAPSAFFVFLEDF-RVTFKKENPNVKAVSAVGKAGGQKWKSMSQAEKAPYEEKAAKRKAEYE 115

  Fly    71 EKLKQWN 77
            :::..:|
plant   116 KQMDAYN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 21/68 (31%)
HMGB1NP_974413.1 PRK05901 1..>171 CDD:235640 22/72 (31%)
HMG-box_AtHMGB1-like 54..114 CDD:438821 18/60 (30%)

Return to query results.
Submit another query.