DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and sox18

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_017209261.1 Gene:sox18 / 797246 ZFINID:ZDB-GENE-080725-1 Length:431 Species:Danio rerio


Alignment Length:83 Identity:23/83 - (27%)
Similarity:42/83 - (50%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAE-- 68
            :|.::||:|||:|.... ||.:..::||.....:|...|:.|:|::..||..:.|.|.....:  
Zfish    92 SRIRRPMNAFMVWAKDE-RKRLAIQNPDLHNAVLSKMLGQSWKALSTLDKRPFVEEAERLRLQHL 155

  Fly    69 -----YKEKLKQWNFPKE 81
                 ||.:.::...||:
Zfish   156 QDHPNYKYRPRRKKQPKK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/74 (27%)
sox18XP_017209261.1 HMG-box_SoxF_SOX18 91..170 CDD:438851 21/78 (27%)
Sox17_18_mid 211..261 CDD:463454
PHA03420 <264..>315 CDD:177648
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.