DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Hmgb4

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_081312.2 Gene:Hmgb4 / 69317 MGIID:1916567 Length:181 Species:Mus musculus


Alignment Length:94 Identity:25/94 - (26%)
Similarity:45/94 - (47%) Gaps:25/94 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKH---IKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEY 69
            |:||.|:|:|:    .|.|   :|.|:||::|.:|:...|:||....:.:|..:::.|....|:|
Mouse    93 PRKPPSSFLLF----SRDHYAMLKQENPDWTVVQVAKAAGKMWSTTDEAEKKPYEQKAALMRAKY 153

  Fly    70 KEKLKQWNFPKEHRFSDTQCICSSNTNQC 98
            .|:.:.:.                  |||
Mouse   154 FEEQEAYR------------------NQC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/70 (31%)
Hmgb4NP_081312.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100 4/6 (67%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.