DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and SOX11

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_003099.1 Gene:SOX11 / 6664 HGNCID:11191 Length:441 Species:Homo sapiens


Alignment Length:77 Identity:25/77 - (32%)
Similarity:41/77 - (53%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTA----MAEY 69
            |:||:|||:| :...|:.|..:.||....|:|.:.|:.|:.:.|.:||.:...|...    ||:|
Human    50 KRPMNAFMVW-SKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADY 113

  Fly    70 KE-KLKQWNFPK 80
            .: |.:....||
Human   114 PDYKYRPRKKPK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 23/71 (32%)
SOX11NP_003099.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG-box_SoxC_SOX11 38..129 CDD:438846 25/77 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..216 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..359
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000250|UniProtKB:Q7M6Y2 409..441
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.