DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and SOX10

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_008872.1 Gene:SOX10 / 6663 HGNCID:11190 Length:466 Species:Homo sapiens


Alignment Length:91 Identity:23/91 - (25%)
Similarity:44/91 - (48%) Gaps:4/91 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:|..:..|| :..::|.....|:|...|::||.:.:.||..:.|.|.....::|:..
Human   105 KRPMNAFMVWAQAARRK-LADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDH 168

  Fly    74 KQWNFPKEHRFSDTQCICSSNTNQCP 99
            ..:.:....|.:..   .:....:||
Human   169 PDYKYQPRRRKNGK---AAQGEAECP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/66 (30%)
SOX10NP_008872.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..67
Sox_N 12..93 CDD:463586
Dimerization (DIM). /evidence=ECO:0000303|PubMed:31194875 62..102
HMG-box_SoxE 103..177 CDD:438840 20/72 (28%)
Nuclear export signal 134..145 4/10 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..199 4/35 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..274
Transactivation domain (TAM). /evidence=ECO:0000303|PubMed:31194875 228..310
Transactivation domain (TAC). /evidence=ECO:0000303|PubMed:31194875 353..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..466
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.