DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmgb2a

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001032501.2 Gene:hmgb2a / 641484 ZFINID:ZDB-GENE-051120-126 Length:213 Species:Danio rerio


Alignment Length:64 Identity:19/64 - (29%)
Similarity:39/64 - (60%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKE 71
            ||:|.|||.::. |..|..:|.::|..|:.:::.|.||||..::.::|..:::.|.....:|::
Zfish    95 PKRPPSAFFVFC-SDHRPKVKGDNPGISIGDIAKKLGEMWSKLSPKEKSPYEQKAMKLKEKYEK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 19/64 (30%)
hmgb2aNP_001032501.2 HMG-box_HMGB_rpt1 7..75 CDD:438794
HMG-box_HMGB_rpt2 93..163 CDD:438795 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.