DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmg20a

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001006760.1 Gene:hmg20a / 448440 XenbaseID:XB-GENE-955353 Length:345 Species:Xenopus tropicalis


Alignment Length:69 Identity:17/69 - (24%)
Similarity:35/69 - (50%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            ||.|::.::.:||.. |:.::.|.||....|::...|..|..:...:|..:.:.|......|.::
 Frog   101 PKAPLTGYVRFMNER-REQLRTERPDVPFPEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKE 164

  Fly    73 LKQW 76
            |:|:
 Frog   165 LQQY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 16/67 (24%)
hmg20aNP_001006760.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..124 7/23 (30%)
HMG-box_HMG20A 81..184 CDD:438833 17/69 (25%)
SMC_prok_B <151..>292 CDD:274008 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..198 1/2 (50%)

Return to query results.
Submit another query.