DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and hmgb3

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001004888.1 Gene:hmgb3 / 448228 XenbaseID:XB-GENE-1002014 Length:202 Species:Xenopus tropicalis


Alignment Length:74 Identity:26/74 - (35%)
Similarity:38/74 - (51%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTA------- 65
            ||:|.|.|.|:. |..|..||:.:|..|:.:|:.|.||||..:.|.:|..:...|...       
 Frog    93 PKRPPSGFFLFC-SEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDGEKQPYNNKAAKLKEKYEKD 156

  Fly    66 MAEYKEKLK 74
            :|:||.|.|
 Frog   157 VADYKSKGK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 26/74 (35%)
hmgb3NP_001004888.1 HMG-box_HMGB_rpt1 13..76 CDD:438794
HMG-box_HMGB_rpt2 91..161 CDD:438795 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.