DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Sox21a

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001261827.1 Gene:Sox21a / 39567 FlyBaseID:FBgn0036411 Length:407 Species:Drosophila melanogaster


Alignment Length:74 Identity:20/74 - (27%)
Similarity:34/74 - (45%) Gaps:10/74 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEKL 73
            |:||:|||:|.....|| :..::|.....|:|.:.|..|:.:.:..|..:.:.|....|.:.   
  Fly   122 KRPMNAFMVWSRGQRRK-MAQDNPKMHNSEISKRLGAEWKLLTEGQKRPFIDEAKRLRALHM--- 182

  Fly    74 KQWNFPKEH 82
                  |||
  Fly   183 ------KEH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 17/66 (26%)
Sox21aNP_001261827.1 HMG-box_SoxB 119..198 CDD:438790 20/74 (27%)

Return to query results.
Submit another query.