DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Sox15

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_061509362.1 Gene:Sox15 / 3291495 VectorBaseID:AGAMI1_010058 Length:901 Species:Anopheles gambiae


Alignment Length:57 Identity:20/57 - (35%)
Similarity:34/57 - (59%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ARPKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESA 62
            ||.::||:|||:|. ...||.:..|:||....::|...|:.||::..:|:..:.|.|
Mosquito   195 ARIRRPMNAFMVWA-KVERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 18/55 (33%)
Sox15XP_061509362.1 None

Return to query results.
Submit another query.