DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and TOX3

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001073899.2 Gene:TOX3 / 27324 HGNCID:11972 Length:576 Species:Homo sapiens


Alignment Length:66 Identity:22/66 - (33%)
Similarity:37/66 - (56%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||:||:.|:...| :..||.::|:.:..|||.....||.::.:|.|.|::.....|..||.:.
Human   255 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 318

  Fly    73 L 73
            |
Human   319 L 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/66 (33%)
TOX3NP_001073899.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258 1/2 (50%)
HMG-box_TOX-like 256..325 CDD:438811 21/65 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..563
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.