DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Tox2

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001359507.1 Gene:Tox2 / 269389 MGIID:3611233 Length:541 Species:Mus musculus


Alignment Length:66 Identity:20/66 - (30%)
Similarity:35/66 - (53%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||:||:.|:...| :..||.::|..:..:||.....||.::.:|.|..::.....|..||.:.
Mouse   272 PQKPVSAYALFFRDT-QAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKA 335

  Fly    73 L 73
            |
Mouse   336 L 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 20/66 (30%)
Tox2NP_001359507.1 HMG-box_TOX-like 273..342 CDD:438811 19/65 (29%)

Return to query results.
Submit another query.