DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tHMG1 and Tox4

DIOPT Version :10

Sequence 1:NP_651055.1 Gene:tHMG1 / 42650 FlyBaseID:FBgn0038978 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_075923.2 Gene:Tox4 / 268741 MGIID:1915389 Length:619 Species:Mus musculus


Alignment Length:106 Identity:28/106 - (26%)
Similarity:49/106 - (46%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKKPMSAFMLWMNSTGRKHIKAEHPDFSVQEVSVKGGEMWRAMADEDKIVWQESATTAMAEYKEK 72
            |:||:||:.|:...| :..||.::|:.:..|||.....||.::.:|.|.|::.....|..||.:.
Mouse   223 PQKPVSAYALFFRDT-QAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKA 286

  Fly    73 LKQWNFPKEHRFSDTQCICSSNTNQCPTLFVYDTMDDSMTP 113
            |..:.       .:.:|..:..|.:      .|.:..|.||
Mouse   287 LAAYK-------DNQECQATVETVE------LDPVPQSQTP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tHMG1NP_651055.1 HMG_box 8..76 CDD:459837 22/67 (33%)
Tox4NP_075923.2 NHP6B 140..>306 CDD:227935 24/96 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 2/3 (67%)
Nuclear localization signal. /evidence=ECO:0000255, ECO:0000269|PubMed:34914893 213..218
HMG-box_TOX-like 224..293 CDD:438811 21/76 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..335 4/9 (44%)
Peptidase_S21 <464..530 CDD:330753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.